PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000587003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 160aa    MW: 18645.4 Da    PI: 7.4332
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000587003genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM552.7e-172081162
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFs 62
                   l pGfrFhPtdeel+ +yL +k+++ ++++ ++i+ vd++k+ePw+L+ +++ +  e++ + 
  MDP0000587003 20 LSPGFRFHPTDEELIICYLMNKINDATFTTXRAIAXVDLNKCEPWELHLHLHLSXLEMFXYR 81
                   579***************************999**************965555555665554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-161584IPR003441NAC domain
PROSITE profilePS5100510.73820159IPR003441NAC domain
PfamPF023655.6E-822116IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MTVHHLLSLL PSDPKEELPL SPGFRFHPTD EELIICYLMN KINDATFTTX RAIAXVDLNK  60
CEPWELHLHL HLSXLEMFXY RXLHPRRHXP KEPQQPPLLL HHKHRNQFWF WXYNFSKGQD  120
PNKVNAIALC RGDLSHDACH TXLNDSINAL LQNCSTHPK*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.29e-18NAC domain containing protein 38